Peptides

Peptide YY (3-36), human

$154.00
Check your price
  • Cat.Number : AS-24405
  • Availability :
    In stock

Select specification

Size

Quantity

This peptide, a PYY (3-36), a Y2R agonist, is released from the gastrointestinal tract postprandially in proportion to the calorie content of a meal and can inhibit food intake.

Specifications

Chemistry
Sequence one letter code
  • IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2
Sequence three letter code
  • H-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2
CAS registry number
  • 123583-37-9
Molecular Formula
  • C180H279N53O54
Molecular Mass/ Weight
  • 4049.7
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
  • Peak Area by HPLC ≥95%
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20 °C
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • human

You may also be interested in the following product(s)

IMG-EN-AS-24252-01.jpg

Caerulein, Ceruletide - 1 mg

Cat.Number : AS-24252
$214.00 Excl. Tax
IMG-EN-AS-60677-01.jpg

Secretin, rat - 1 mg

Cat.Number : AS-60677
$238.00 Excl. Tax
IMG-EN-AS-72209-01.jpg

SensoLyte® 520 Enterokinase Assay Kit Fluorimetric - 1 kit

Cat.Number : AS-72209
$552.00 Excl. Tax