Peptides

Peptide YY, human

$154.00
Check your price
  • Cat.Number : AS-24401
  • Availability :
    In stock

Select specification

Size

Quantity

PYY is a 36-amino acid regulatory gut hormone present in endocrine cells in the intestine. This peptide acts both as an endocrine and a paracrine agent.

Specifications

Chemistry
Sequence one letter code
  • YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2
Sequence three letter code
  • H-Tyr-Pro-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2
CAS registry number
  • 118997-30-1
Molecular Formula
  • C194H295N55O57
Molecular Mass/ Weight
  • 4310
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
  • Peak Area by HPLC ≥95%
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20 °C
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • human

You may also be interested in the following product(s)

IMG-EN-AS-24252-01.jpg

Caerulein, Ceruletide - 1 mg

Cat.Number : AS-24252
$214.00 Excl. Tax
IMG-EN-AS-60677-01.jpg

Secretin, rat - 1 mg

Cat.Number : AS-60677
$238.00 Excl. Tax
IMG-EN-AS-72209-01.jpg

SensoLyte® 520 Enterokinase Assay Kit Fluorimetric - 1 kit

Cat.Number : AS-72209
$552.00 Excl. Tax

References

Isolation and primary structure of human peptide YY

BBRC . 1988 Dec 15 ; 157(2) 713 | DOI : https://doi.org/10.1016/S0006-291X(88)80308-5

  • K. Tatemoto
  • et al

Evidence for a Role of the Gut Hormone PYY in the Regulation of Intestinal Fatty Acid-binding Protein Transcripts in Differentiated Subpopulations of Intestinal Epithelial Cell Hybrids

J biol Chem . 1997 May 09 ; 272(19) 12591 | DOI : https://doi.org/10.1074/jbc.272.19.12591

  • G. Halldén
  • G. Aponte

Gut hormones in the control of appetite

Exp Physiology . 2004 Aug 19 ; 89(5) 507 | DOI : https://doi.org/10.1113/expphysiol.2004.027789

  • KG. Murphy
  • SR. Bloom

Gut hormone PYY3-36 physiologically inhibits food intake

Nature . 2002 Aug 08 ; 418 650

  • R. Batterham
  • et al

A Novel Glucose-Sensing Mechanism Contributing to Glucagon-Like Peptide-1 Secretion From the GLUTag Cell Line

Diabetes . 2003 May 01 ; 52(5) 1147 | DOI : https://doi.org/10.2337/diabetes.52.5.1147

  • F. Gribble
  • et al

Inhibition of Food Intake in Obese Subjects by Peptide YY3–36

N Engl J Med . 2003 Sep 04 ; 349 941 | DOI : 10.1056/NEJMoa030204

  • R. Batterham
  • et al