Product Name |
GMP beta-Amyloid (1-40), human (Ammonium Salt) |
Size |
5 mg NET peptide |
Catalog Number |
AS-GMP-24236-5 |
US$ |
$2,420 |
Description |
This highly pure, well-characterized GMP beta-Amyloid (1-40) peptide has been produced under conditions compliant with 21 CFR part 820 and ISO 13485.
Features & Benefits
- Added Assurance for your high profile projects
- Compliant with 21 CFR part 820 and ISO 13485
- Manufactured in controlled areas under SOP's, BR's, with qualified equipment and staff
- Lot to lot reproducibility, consistency, and traceability
- Comprehensive QC Testing and characterization
|
Applications*
Ideal for:
- In Vitro Diagnostics
- QC Controls & Standards
- Pre-Clinical animal studies
-
- *not to be used as an API in it's current form.
|
Testing
Additional test results available on Certificate of Analysis
Attribute |
Result |
Peptide Purity |
≥97% |
Endotoxin |
<0.05 EU/mg |
Bioburden |
<1 CFU/mg |
Solubility |
Aqueous media (see CoA) |
Monomer content |
100% |
|
Detailed Information |
DataSheet
Material Safety Data Sheets (MSDS)
|
Storage |
≤-15°C, Dry |
References |
- Wang X., et.al.,Scientific Reports.(8): 4634 (2018)
- Zhao Y., et.al.,Neuroimage.(148):296-304 (2017)
- Wang CY.,et.al., Alzheimer's Dement.(3):262-272 (2017)
- Sun L., et al. Nanmedicine.(13):843 (2018)
- Carneiro P., et al. Sensors & Actuators B:Chem. (239):157-65 (2017)
- Wang JS., et al. J Am Soc Mass Spec.(4):786-795 (2018)
- Leinbach A., et al. Clin Chem. 60(7):987-94 (2014)
|
Molecular Weight |
4329.7 Da ± 0.2% |
Sequence (one-letter-code) |
H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-OH |
Sequence (three-letter-code) |
NH2 - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - COOH |
|
|
|
|