Login

Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
	Stay Logged In

Forgot your Customer ID or Password?

New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides > Neuropeptide Y and Analogs >> Neuropeptide Y, human, rat

Product Name	Neuropeptide Y, human, rat YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY - NH2
Size	1 mg
Catalog #	AS-22465
US$	$181
Purity	% Peak Area By HPLC ≥ 95%
Detailed Information	Datasheet Material Safety Data Sheets (MSDS)
Storage	-20°C
References	Ref: Minth, C. et al. Proc. Natl. Acad. Sci. USA 81, 4577 (1984).
Molecular Weight	4271.8
Sequence (One-Letter Code)	YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2
Sequence (Three-Letter Code)	H - Tyr - Pro - Ser - Lys - Pro - Asp - Asn - Pro - Gly - Glu - Asp - Ala - Pro - Ala - Glu - Asp - Met - Ala - Arg - Tyr - Tyr - Ser - Ala - Leu - Arg - His - Tyr - Ile - Asn - Leu - Ile - Thr - Arg - Gln - Arg - Tyr - NH2
Product Citations	Shrivastava, A. et al. (2013). Heterobivalent dual-target probe for targeting GRP and Y1 receptors on tumor cells. Bioorg Med Chem Lett 23, 687. doi: 10.1016/j.bmcl.2012.11.110. Pelz, KM. & J. Dark (2007). ICV NPY Y1 receptor agonist but not Y5 agonist induces torpor-like hypothermia in cold-acclimated Siberian hamsters. Am J Physiol Regulatory Integrative Comp Physiol 292, R2299. Gao, J. et al. (2004). Selective activation of central NPY Y1 vs. Y5 receptor elicits hyperinsulinemia via distinct mechanisms. Am J Physiol Endocrinol Metab 287, E706. doi: 10.1152/ajpendo.00530.2003. Kapoor, JR. and CD. Sladek. (2001). Substance P and NPY differentially potentiate ATP and adrenergic stimulated vasopressin and oxytocin release. Am J Physiol Regul Integr Comp Physiol 280, R69.

Copyright © 2002-2017 AnaSpec, Inc. All rights reserved. | Site Map | Terms & Conditions | 1-800-452-5530