Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Pituitary Adenylate Cyclase Activating Peptides (PACAPS)  >>  PACAP (6-38), amide, human, ovine, rat

Product Name PACAP (6 - 38), amide, human, ovine, rat
FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK - NH2
Size 0.5 mg
Catalog # 22516
US$ $171
Purity % Peak Area By HPLC ≥ 95%
Description

This peptide is a potent antagonist of PACAP 38 and is much more potent and selective than PACAP (6-27) in the inhibition of PACAP-27 stimulated pituitary adenylate cyclase. The Ki values for the inhibition of the enzyme are 7nM and 150 nM, respectively.

Storage -20C
References Ref: Robberecht, P. et al. Eur. J. Biochem. 207, 239 (1992).
Molecular Weight 4024.8
Sequence
(One-Letter Code)
FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2
Sequence
(Three-Letter Code)
H - Phe - Thr - Asp - Ser - Tyr - Ser - Arg - Tyr - Arg - Lys - Gln - Met - Ala - Val - Lys - Lys - Tyr - Leu - Ala - Ala - Val - Leu - Gly - Lys - Arg - Tyr - Lys - Gln - Arg - Val - Lys - Asn - Lys - NH2
     
  < Back