Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Nesfatins  >>  Nesfatin-1 (24-53), mouse

Product Name Nesfatin - 1 (24 - 53), mouse
Size 0.5 mg
Catalog # AS-65572
US$ $194
Description

Nesfatin-1 was recently identified as anorexigenic peptide and is derived from Nucleobindin2 protein. Nesfatin-1 reduces body weight gain, food and water intake in rodents. In humans high levels of Nesfatin-1 in plasma are associated with overweight individuals. In addition, Nesfatin-1 was linked to the anxiety and stress.

Detailed Information Datasheet
Material Safety Data Sheets (MSDS)
Storage –20°C
References 1. Feijóo-Bandín S., et.al., Endocrinology 154 (12), 4757-4767 (2013)
2. Vas S., et.al., PLOS 8 (4), 1-10 (2013)
3. Ramanjaneya M., et.al., Endocrinology 151 (7), 3169-3180 (2010)
Molecular Weight 3667.3
Sequence
(One-Letter Code)
PDTGLYYDEYLKQVIEVLETDPHFREKLQK-NH2
Sequence
(Three-Letter Code)
Pro - Asp - Thr - Gly - Leu - Tyr - Tyr - Asp - Glu - Tyr - Leu - Lys - Gln - Val - Ile - Glu - Val - Leu - Glu - Thr - Asp - Pro - His - Phe - Arg - Glu - Lys - Leu - Gln - Lys - NH2
     
  < Back