Peptides

ACTH (7-38), human - 1 mg

$125.00
Check your price
  • Cat.Number : AS-20618
  • Availability :
    In production

Select specification

Quantity

Corticotropin-inhibiting peptide (CIP), the 7-38 fragment of human ACTH (1-39), is known to act as an antagonist of ACTH receptors. It does not have any corticosteroidogenic activity.

Specifications

Chemistry
Sequence one letter code
  • FRWGKPVGKKRRPVKVYPNGAEDESAEAFPLE
Sequence three letter code
  • H-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-OH
CAS registry number
  • 68563-24-6
Molecular Formula
  • C167H257N47O46
Molecular Mass/ Weight
  • 3659.4
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
  • Peak Area by HPLC ≥95%
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20 °C
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • human

You may also be interested in the following product(s)