Peptides

Amylin (1-37), rat, mouse

$334.00
Check your price
  • Cat.Number : AS-60253-05
  • Availability :
    In stock

Select specification

Size

Quantity

Rat/mouse Amylin differs from the human version in 6 amino acids: H18R, F23L, A25P, I26V, S28P and S29P (first letter is the amino acid of the human sequence). Unlike the human IAPP (Amylin), rat Amylin does not form amyloid fibers.

Specifications

Chemistry
Sequence one letter code
  • KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2 (Disulfide bridge: 2-7)
Sequence three letter code
  • H-Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-Arg-Ser-Ser-Asn-Asn-Leu-Gly-Pro-Val-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2 (Disulfide bridge: 2-7)
CAS registry number
  • 124447-81-0
Molecular Formula
  • C167H272N52O53S2
Molecular Mass/ Weight
  • 3920.6
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
  • Peak Area by HPLC ≥95%
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20 °C
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • rat, mouse

You may also be interested in the following product(s)

IMG-EN-AS-22456-01.jpg

Glucagon (1-29), bovine, human, rat, porcine

Cat.Number : AS-22456
$77.00
IMG-EN-AS-61532-01.jpg

Insulin B (9-23) - 1 mg

Cat.Number : AS-61532
$124.00

Citations

Influence of the Human and Rat Islet Amyloid Polypeptides on Structure of Phospholipid Bilayers: Neutron Reflectometry and Fluorescence Microscopy Studies.

Langmuir . 2016 Apr 21 ; 32(17) 4382 | DOI : 10.1021/acs.langmuir.6b00825

  • A. Junghans

References

Direct detection of transient α-helical states in islet amyloid polypeptide

Protein Sci . 2007 Jan 01 ; 16(1) 110 | DOI : https://doi.org/10.1110/ps.062486907

  • JA. Williamson
  • AD. Miranker