Peptides

Amylin (8-37), rat, mouse - 1 mg

$261.00
Check your price
  • Cat.Number : AS-21749
  • Availability :
    In production

Select specification

Quantity

This is a truncated peptide of native rat amylin. In-vivo and in-vitro studies suggest that it acts as a specific amylin antagonist. In isolated soleus muscle, it blocks amylin-induced inhibition of glycogen synthesis but has no effect in the absence of amylin. Amylin (8-37) increases whole body and muscle insulin sensitivity and consistently reduces basal insulin levels in normal and hGH-induced insulin-resistant rats. It also elicits a significant alteration of in-vivo lipid metabolism.

Specifications

Chemistry
Sequence one letter code
  • ATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2
Sequence three letter code
  • H-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-Arg-Ser-Ser-Asn-Asn-Leu-Gly-Pro-Val-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2
CAS registry number
  • 138398-61-5
Molecular Formula
  • C140H227N43O43
Molecular Mass/ Weight
  • 3200.8
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
  • Peak Area by HPLC ≥95%
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20 °C
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • rat

You may also be interested in the following product(s)

IMG-EN-AS-22456-01.jpg

Glucagon (1-29), bovine, human, rat, porcine

Cat.Number : AS-22456
$77.00
IMG-EN-AS-61532-01.jpg

Insulin B (9-23) - 1 mg

Cat.Number : AS-61532
$124.00

References

Amylin or CGRP (8–37) fragments reverse amylin-induced inhibition of 14C-glycogen accumulation

Biochem Biophys Res Commun . 1991 Nov 27 ; 181(1) 116 | DOI : https://doi.org/10.1016/S0006-291X(05)81389-0

  • RO. Deems
  • et al

Rat amylin-(8—37) enhances insulin action and alters lipid metabolism in normal and insulin-resistant rats

J Physiol Endocrinol Metab . 1997 Nov 01 ; 273(5) E859 | DOI : https://doi.org/10.1152/ajpendo.1997.273.5.E859

  • M. Hettiarachchi
  • et al