Peptides

Beta-Amyloid (1-34) - 0.5 mg

$181.00
Check your price
  • Cat.Number : AS-61799
  • Availability :
    In stock

Quantity

Beta-amyloid is the main component of amyloid deposits in the AD brain. Beta-amyloid peptides have a heterogeneous C-terminus with the majority composed ofAβ?-40, while a minor product is Aβ?1-42. Additional minor Aβ?peptides are also normally produced, such as Beta-amyloid 1-34, 1-37, 1-38 and 1-39, and few reports have quantified the levels of these peptides in the brain.

Specifications

Chemistry
Sequence one letter code
  • DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL
Sequence three letter code
  • H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-OH
Molecular Formula
  • C170H253N47O52
Molecular Mass/ Weight
  • 3787.4
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
  • ≥ 95%
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20 °C
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • human

You may also be interested in the following product(s)