Peptides

Beta-Amyloid (1-43)

$370.00
Check your price
  • Cat.Number : AS-25356
  • Availability :
    In stock

Size

Quantity

Solid Aß (1-43) fibril is the most fibrillogenic of all the Aß peptides known.

Specifications

Chemistry
Sequence one letter code
  • DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIAT
Sequence three letter code
  • H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-Thr-OH
CAS registry number
  • 134500-80-4
Molecular Formula
  • C207H318N56O62S
Molecular Mass/ Weight
  • 4615.5
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
  • Peak Area by HPLC ≥95%
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20 °C
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • human

You may also be interested in the following product(s)

References

Computationally derived structural models of the β-amyloid found in Alzheimer's disease plaques and the interaction with possible aggregation inhibitors

Biopolymer . 1999 Dec 01 ; 50(7) 733 | DOI : https://doi.org/10.1002/(SICI)1097-0282(199912)50:7<733::AID-BIP6>3.0.CO;2-7

  • AR. George
  • DR. Howlett