Peptides

Beta-Amyloid (3-42)

$101.00
Check your price
  • Cat.Number : AS-63715-01
  • Availability :
    In stock

Select specification

Size

Quantity

This peptide is beta-amyloid (1-42) N-terminally truncated. It is the non-pyroglatamate form of beta-Amyloid (3-42). N-terminally truncated pyroglutamate-modified beta-Amyloid forms such as Aß(3-42) and Aß (11- 42) have been described as major compounds in the senile plaques. Pyro-Glu modified beta-Amyloid forms are more resistant to degradation, show higher toxicity and have increased aggregation propensity compared to non-modified beta-Amyloid.

Pyroglutamyl (pGlu) peptides may spontaneously form when either Glutamine (Q) or Glutamic acid (E) is located at the sequence N-terminus. The conversion of Q or E to pGlu is a natural occurrence and in general it is believed that the hydrophobic γ-lactam ring of pGlu may play a role in peptide stability against gastrointestinal proteases. Pyroglutamyl peptides are therefore considered a normal subset of such peptides and are included as part of the peptide purity during HPLC analysis.

Specifications

Chemistry
Sequence one letter code
  • EFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Sequence three letter code
  • H-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OH
Molecular Formula
  • C196H301N53O56S
Molecular Mass/ Weight
  • 4328.2
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
  • Peak Area by HPLC ≥95%
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20 °C
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • human

You may also be interested in the following product(s)

IMG-EN-AS-20276-01.jpg

Beta-Amyloid (1-42)

Cat.Number : AS-20276
$310.00 Excl. Tax

Citations

Pyroglutamate Abeta pathology in APP/PS1KI mice, sporadic and familial Alzheimer’s disease cases

J Neural Transm . 2010 Jan 01 ; 117(1) 85 | DOI : 10.1007/s00702-009-0314-x

  • O. Wirths