Peptides

Beta-Amyloid A4 Protein Precursor (740-770), APP (C31) - 1 mg

$274.00
Check your price
  • Cat.Number : AS-62073
  • Availability :
    In stock

Quantity

This 31-amino acid peptide C31 corresponds to the C-terminal fragment of the Amyloid Precursor Protein (APP). Caspase cleavage of amyloid beta-protein precursor with the generation of C31 may be involved in the neuronal death associated with Alzheimer disease. The resultant C31 peptide is a potent inducer of apoptosis. This peptide is located in lipid rafts together with the APP-BP1, a binding protein for the intracellular domain of APP.

Specifications

Chemistry
Sequence one letter code
  • AAVTPEERHLSKMQQNGYENPTYKFFEQMQN
Sequence three letter code
  • H-Ala-Ala-Val-Thr-Pro-Glu-Glu-Arg-His-Leu-Ser-Lys-Met-Gln-Gln-Asn-Gly-Tyr-Glu-Asn-Pro-Thr-Tyr-Lys-Phe-Phe-Glu-Gln-Met-Gln-Asn-OH
CAS registry number
  • 1802086-24-3
Molecular Formula
  • C162H243N45O52S2
Molecular Mass/ Weight
  • 3717.3
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
  • Peak Area by HPLC ≥95%
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20 °C
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • human

You may also be interested in the following product(s)

IMG-EN-AS-20276-01.jpg

Beta-Amyloid (1-42)

Cat.Number : AS-20276
$310.00 Excl. Tax

References

A second cytotoxic proteolytic peptide derived from amyloid β-protein precursor

Nat Med . 2000 Apr 01 ; 6(4) 397 | DOI : 10.1038/74656

  • D. Lu
  • et al

APP-BP1 mediates APP-induced apoptosis and DNA synthesis and is increased in Alzheimer's disease brain

J Cell Biol . 2003 Oct 13 ; 163(1) 27 | DOI : https://doi.org/10.1083/jcb.200304003

  • Y. Chen
  • et al