Products

Discover our full range of catalog products including Labeling and Detection, Peptides, Reagents for peptides synthesis, Assay Kits and Proteins.

Your selection

    1 - 20 of 49

    SARS-CoV-2 Spike receptor binding domain, RBD (395-430) - 0.5 mg

    • VYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFT
    • Cat.Number : AS-65613

    Generic 3CLpro FRET peptide substrate - 0.1 mg

    • Hilyte™ Fluor-488-ESATLQSGLRKAK-(QXL®-520)-NH2
    • Cat.Number : AS-65599

    Spike protein (S1/S2) SARS-CoV-2 substrate - 0.1 mg

    • QXL®520-TNSPRRARSVAS-K(5-FAM)-NH2
    • Cat.Number : AS-65600
      1 - 20 of 49