Products
Discover our full range of catalog products including Labeling and Detection, Peptides, Reagents for peptides synthesis, Assay Kits and Proteins.
1721 - 1740 of 1840
Special Quote - Peptide Synth. Reagents - Item only valid upon quote
- Cat.Number : SQ-ANAA-XXXXX
JC-1 [5,5',6,6'-tetrachloro-1,1',3,3'-tetraethylbenzimidazolylcarbocyanine iodide] - 5 mg
- Cat.Number : AS-88060
Oxonol VI [Bis-(3-propyl-5-oxoisoxazol-4-yl)pentamethine oxonol] - 100 mg
- Cat.Number : AS-84704
GMP Beta-Amyloid (1-40), human
- DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
- Cat.Number : AS-GMP-24236-1
1721 - 1740 of 1840