Peptides

Cys-beta-Amyloid (1-42)

$654.00
Check your price
  • Cat.Number : AS-23537
  • Availability :
    In stock

Select specification

Size

Quantity

Aß (1-42), a major component of amyloid plaques, accumulates in neurons of Alzheimer’s disease brains. Biochemical analysis of the amyloid peptides isolated from Alzheimer’s disease brain indicates that Aß (1-42) is the principal species associated with senile plaque amyloids, while Aß (1-40) is more abundant in cerebrovascular amyloid deposit. This Cys containing mutant can be used as a model for aggregation studies.

Specifications

Chemistry
Sequence one letter code
  • CDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Sequence three letter code
  • H-Cys-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OH
Molecular Formula
  • C206H316N56O61S2
Molecular Mass/ Weight
  • 4617.6
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
  • Peak Area by HPLC ≥90%
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20 °C
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • human

You may also be interested in the following product(s)