Peptides

Des-gamma-carboxylated Osteocalcin (1-49), human - 0.25 mg

$189.00
Check your price
  • Cat.Number : AS-65307-025
  • Availability :
    In stock

Quantity

This peptide is des-gamma-carboxylated osteocalcin/bone Gla protein (BGP). Osteocalcin/BGP is the most abundant non-collagenous protein of the bone extracellular matrix and is secreted by osteoblasts. This des-gamma-carboxylated peptide serves as a substrate for vitamin K-dependent carboxylase, which modifies Glu17, Glu21, and Glu24 to Gla residues.

Specifications

Chemistry
Sequence one letter code
  • YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV (Disulfide bridge:C23-29)
Sequence three letter code
  • H-Tyr-Leu-Tyr-Gln-Trp-Leu-Gly-Ala-Pro-Val-Pro-Tyr-Pro-Asp-Pro-Leu-Glu-Pro-Arg-Arg-Glu-Val-Cys-Glu-Leu-Asn-Pro-Asp-Cys-Asp-Glu-Leu-Ala-Asp-His-Ile-Gly-Phe-Gln-Glu-Ala-Tyr-Arg-Arg-Phe-Tyr-Gly-Pro-Val-OH (Disulfide bridge:C23-29)
Molecular Formula
  • C266H381N67O76S2
Molecular Mass/ Weight
  • 5797.8
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
  • Peak Area by HPLC ≥95%
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20 °C
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • Human, gorilla

You may also be interested in the following product(s)

IMG-EN-AS-20673-01.jpg

Calcitonin, human

Cat.Number : AS-20673
$148.00 Excl. Tax
IMG-EN-AS-20708-01.jpg

Parathyroid Hormone (1-34), human - 1 mg

Cat.Number : AS-20708
$185.00 Excl. Tax
IMG-EN-AS-72149-01.jpg

SensoLyte® 520 Calpain Activity Assay Kit Fluorimetric - 1 kit

Cat.Number : AS-72149
$552.00 Excl. Tax

References

Characteristics and composition of the vitamin K-dependent γ-glutamyl carboxylase-binding domain on osteocalcin

Biochem J . 2002 May 08 ; 364(1) 323 | DOI : https://doi.org/10.1042/bj3640323

  • R. Houben
  • et al

Increased bone formation in osteocalcin-deficient mice

Nature . 1996 Aug 01 ; 382(6590) 448 | DOI : https://doi.org/10.1038/382448a0

  • P. Ducy
  • et al

Isoenzymes of vitamin-K-dependent carboxylase

Biochim Biophys Acta . 1985 Jul 18 ; 830(1) 105 | DOI : https://doi.org/10.1016/0167-4838(85)90138-4

  • M. Ulrich
  • et al

Vitamin K-dependent car☐ylase: utilization of decar☐ylated bone Gla protein and matrix Gla protein as substrates

Biochim Biophys Acta . 1991 May 30 ; 1078(1) 31 | DOI : https://doi.org/10.1016/0167-4838(91)90088-H

  • J. Engelke
  • et al