Peptides

Des-gamma-carboxylated Osteocalcin (1-49), human - 0.25 mg

$180.00
Check your price
  • Cat.Number : AS-65307-025
  • Availability :
    In stock

Quantity

This peptide is des-gamma-carboxylated osteocalcin/bone Gla protein (BGP). Osteocalcin/BGP is the most abundant non-collagenous protein of the bone extracellular matrix and is secreted by osteoblasts. This des-gamma-carboxylated peptide serves as a substrate for vitamin K-dependent carboxylase, which modifies Glu17, Glu21, and Glu24 to Gla residues.

Specifications

Chemistry
Sequence one letter code
  • YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV (Disulfide bridge:C23-29)
Sequence three letter code
  • H-Tyr-Leu-Tyr-Gln-Trp-Leu-Gly-Ala-Pro-Val-Pro-Tyr-Pro-Asp-Pro-Leu-Glu-Pro-Arg-Arg-Glu-Val-Cys-Glu-Leu-Asn-Pro-Asp-Cys-Asp-Glu-Leu-Ala-Asp-His-Ile-Gly-Phe-Gln-Glu-Ala-Tyr-Arg-Arg-Phe-Tyr-Gly-Pro-Val-OH (Disulfide bridge:C23-29)
Molecular Formula
  • C266H381N67O76S2
Molecular Mass/ Weight
  • 5797.8
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
  • Peak Area by HPLC ≥95%
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20 °C
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • Human, gorilla

You may also be interested in the following product(s)

IMG-EN-AS-20673-01.jpg

Calcitonin, human

Cat.Number : AS-20673
$141.00
IMG-EN-AS-20708-01.jpg

Parathyroid Hormone (1-34), human - 1 mg

Cat.Number : AS-20708
$176.00