Peptides

[Gly22]-beta-Amyloid (1-42), Arctic Mutation - 0.5 mg

$397.00
Check your price
  • Cat.Number : AS-61967-05
  • Availability :
    In stock

Select specification

Quantity

This is amino acids 1 to 40 fragment of the mutant form of beta-amyloid, with glycine substituted for glutamic acid at position 22 found in “Arctic” heredity. A toxic soluble beta-amyloid assembly (TA-beta) is formed more rapidly from 'Arctic' beta-amyloid than from wild-type beta-amyloid in the presence of liposomes containing GM1 ganglioside.

Specifications

Chemistry
Sequence one letter code
  • DAEFRHDSGYEVHHQKLVFFAGDVGSNKGAIIGLMVGGVVIA
Sequence three letter code
  • H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Gly-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OH
CAS registry number
  • 1802086-23-2
Molecular Formula
  • C200H307N55O58S
Molecular Mass/ Weight
  • 4442.4
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
  • Peak Area by HPLC ≥95%
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20 °C
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • human

You may also be interested in the following product(s)

References

A Ganglioside-induced Toxic Soluble Aβ Assembly ITS ENHANCED FORMATION FROM AβBEARING THE ARCTIC MUTATION

J Biol Chem . 2007 Jan 01 ; 282(4) 2646 | DOI : https://doi.org/10.1074/jbc.M606202200

  • N. Yamamoto
  • et al