Peptides

[Met]-beta-Amyloid (1-42), 5-TAMRA labeled - 0.1 mg

$272.00
Check your price
  • Cat.Number : AS-64519
  • Availability :
    In stock

Select specification

Quantity

This is beta-amyloid (1-42) peptide with the N-terminal methionine labeled with the fluorescent dye 5-TAMRA (Ex/Em= 544/572 nm).

Specifications

Chemistry
Sequence one letter code
  • 5-TAMRA-MDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Sequence three letter code
  • 5-TAMRA-Met-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OH
Molecular Formula
  • C233H340N58O65S2
Molecular Mass/ Weight
  • 5058.1
Properties
Absorbance (nm)
  • 544
Emission (nm)
  • 572
Modification
Conjugation type
  • Fluorescent dyes
Modification Name
Conjugation
  • Conjugated
Quantity & Purity
Purity
  • Peak Area by HPLC ≥95%
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20 °C Protected from light
Activity
Biomarker Target
Detection Method
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • human

You may also be interested in the following product(s)