Peptides

[Met(O)35]-beta-Amyloid (1-42) - 0.5 mg

$306.00
Check your price
  • Cat.Number : AS-62478
  • Availability :
    In stock

Select specification

Quantity

Beta-amyloid 1-42, the major protein component of brain senile plaques in Alzheimer's disease, is known to be directly responsible for the production of free radicals toxic to brain tissue. The redox state of Met-35 seems to play a role in peptide's neurotoxic actions by altering the cell deatch pathway mediated by Bax / Blc2. In this peptide, Met35 is in the sulfoxide form.

Specifications

Chemistry
Sequence one letter code
  • DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL-M(O)-VGGVVIA
Sequence three letter code
  • H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met(O)-Val-Gly-Gly-Val-Val-Ile-Ala-OH
CAS registry number
  • 1802086-68-5
Molecular Formula
  • C203H311N55O61S
Molecular Mass/ Weight
  • 4530.4
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
  • ≥ 95%
Storage & stability
Form
  • Lyophilized
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • human

You may also be interested in the following product(s)