Peptides

Pramlintide, Acetate [Pro25, 28, 29]-Amylin(1-37), human, Amide - 1 mg

$296.00
Check your price
  • Cat.Number : AS-64576-1
  • Availability :
    In stock

Quantity

Pramlintide is the first in the new class of amylinomimetic compounds and is a synthetic analogue of the human hormone Amylin, a 37 amino acid peptide. Pramlintide’s peptide sequence differs from Amylin by replacing proline at postitions 25, 28, and 29. Pramlintide has a disulfide bridge between C2 and C7. For Research Use Only.

Specifications

Chemistry
Sequence one letter code
  • KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-NH2 (Disulfide bridge), acetate salt
Sequence three letter code
  • H-Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-His-Ser-Ser-Asn-Asn-Phe-Gly-Pro-Ile-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2 acetate salt (S-S Bond)
CAS registry number
  • 196078-30-5
Molecular Formula
  • C171H269N51O53S2
Molecular Mass/ Weight
  • 3949.6
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
  • Peak Area by HPLC ≥95%
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20 °C
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • human

You may also be interested in the following product(s)

IMG-EN-AS-22456-01.jpg

Glucagon (1-29), bovine, human, rat, porcine

Cat.Number : AS-22456
$77.00 Excl. Tax
IMG-EN-AS-61532-01.jpg

Insulin B (9-23) - 1 mg

Cat.Number : AS-61532
$124.00 Excl. Tax
IMG-EN-AS-72231-01.jpg

SensoLyte® 520 IDE Activity Assay Kit Fluorimetric - 1 kit

Cat.Number : AS-72231
$552.00 Excl. Tax

References

Pramlintide acetate

Am J Health-System Pharmacy . 2005 Nov 15 ; 62(22) 2363 | DOI : 10.2146/ajhp050341

  • J. McQueen
  • et al