Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Glucagon-Like Peptides  >>  Biotin-Glucagon-Like Peptide 1, GLP-1 (7-36), amide, human

Product Name Biotin - Glucagon - Like Peptide 1, GLP - 1 (7 - 36), amide, human
Biotin - HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR - NH2
Size 0.5 mg
Catalog # AS-23586
US$ $198
Purity % Peak Area By HPLC ≥ 95%
Description

This GLP-1 (7-36) amide, is labeled with biotin at the peptide N-terminus. GLP-1 (7-36) amide is an incretin hormone that causes glucose dependent release of insulin by pancreatic beta cells. It is the cleavage product of GLP-1 (1-36) amide peptide (Cat# AS-22460). Both GLP-1 (7-36) and GLP-1 (7-37)-Cat# AS-20761, also play roles in gastric motility (gastric emptying), on the suppression of plasma glucagon levels (glucose production) and possibly on the promotion of satiety and stimulation of glucose disposal in peripheral tissues independent of the actions of insulin. GLP-1 (7-36) has a short half life of less than 2 minutes, and like GIP, is rapidly degraded by the enzyme dipeptidyl peptidase IV (DPP-4), which is widely expressed in a number of sites, including the endothelial cells of small gut arterioles. DPP-4 degrades GLP-1 (7-36) into the non insulinotropic GLP-1 (9-36)-Cat# AS-65070 (some studies suggest it may have weak insulinotropic activity). As a result, the majority of GLP-1 (and GIP) is inactivated as an insulinotrope before reaching the systemic circulation.

Detailed Information Material Safety Data Sheets (MSDS)
Storage -20C
References Drucker, D. et al. Proc Natl Acad Sci USA 84, 3434 (1987)
Kieffer, T. and J. Habener, Endo Rev 20, 876 (1999)
Deacon, CF. et. al. Hormone Metabolic Res 36,761 (2004), doi: 10.1055/s-2004-826160
Williams, JA. Pancreadepedia (2014), doi: 10.3998/panc.2014.7
Elahi, D. et. al. Obesity (Silver Spring) 16, 1501 (2008), doi: 10.1038/oby.2008.229
Ban, K. et. al. Endocrinol 151, 1520 (2010), doi: http://dx.doi.org/10.1210/en.2009-1197
Molecular Weight 3524
Sequence
(One-Letter Code)
Biotin-HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
Sequence
(Three-Letter Code)
Biotin - His - Ala - Glu - Gly - Thr - Phe - Thr - Ser - Asp - Val - Ser - Ser - Tyr - Leu - Glu - Gly - Gln - Ala - Ala - Lys - Glu - Phe - Ile - Ala - Trp - Leu - Val - Lys - Gly - Arg - NH2
     
  < Back