Products

Discover our full range of catalog products including Labeling and Detection, Peptides, Reagents for peptides synthesis, Assay Kits and Proteins.

    1 - 7 of 7

    HCV Protease FRET Substrate (RET S1)

    • Ac-DE-D(Edans)-EE-Abu-ψ-[COO]-AS-K(Dabcyl)-NH2
    • Cat.Number : AS-22991

    HCV NS3/4A Protease Substrate - 1 mg

    • Ac-DE-Dap(QXL®520)-EE-Abu-ψ-[COO]AS-C(5-FAMsp)-NH2
    • Cat.Number : AS-60798

    PEP1 - 1 mg

    • SGSWLRDVWDWICTVLTDFKTWLQSKLDYKD-NH2
    • Cat.Number : AS-60430-1

    HCV NS3 Protease Inhibitor 2 - 1 mg

    • Ac-DE-Dif-E-Cha-C
    • Cat.Number : AS-25346
      1 - 7 of 7