Peptides
AnaSpec manufactures many categories of peptides in Fremont, California, USA. Peptides represent over decades of innovative peptide synthesis expertise.
1 - 11 of 11
HIV Substrate, HiLyte™ Fluor 488 - 0.1 mg
- QXL®520-GABA-SQNYPIVQ-K(HiLyte™ Fluor 488)-NH2
- Cat.Number : AS-60635
T20, Enfuvirtide - 1 mg
- Ac-YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF-NH2
- Cat.Number : AS-61235
HCV NS3/4A Protease Substrate - 1 mg
- Ac-DE-Dap(QXL®520)-EE-Abu-ψ-[COO]AS-C(5-FAMsp)-NH2
- Cat.Number : AS-60798
HCV Protease FRET Substrate (RET S1)
- Ac-DE-D(Edans)-EE-Abu-ψ-[COO]-AS-K(Dabcyl)-NH2
- Cat.Number : AS-22991
Prostatic Acid Phosphatase (248-286), PAP (248-286) - 1 mg
- GIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMY
- Cat.Number : AS-64518
1 - 11 of 11