Products
Discover our full range of catalog products including Labeling and Detection, Peptides, Reagents for peptides synthesis, Assay Kits and Proteins.
1 - 15 of 15
Ryanodine receptor 1 (RyR1) (3614-3643); Calmodulin Binding Peptide (CaMBP) - 1 mg
- KSKKAVWHKLLSKQRRRAVVACFRMTPLYN
- Cat.Number : AS-64606
Chlorotoxin (Cltx) - 0.1 mg
- MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR-NH2 (Disulfide bridge: 2-19,5-28,16-33,20-35)
- Cat.Number : AS-60770
TET 830 modified/T-helper epitope from tetanus toxoid - 1 mg
- AQYIKANSKFIGITEL
- Cat.Number : AS-60622
Charybdotoxin - 0.1 mg
- Pyr-FTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS (Disulfide bridge: 7-28, 13-33 and 17-35)
- Cat.Number : AS-28244
Delta-Toxin (1-26), Staphylococcus aureus - 1 mg
- MAQDIISTIGDLVKWIIDTVNKFTKK
- Cat.Number : AS-62496
MQAE [N-(Ethoxycarbonylmethyl)-6-methoxyquinolinium bromide] - 100 mg
- Cat.Number : AS-84925
1 - 15 of 15