Products
Discover our full range of catalog products including Labeling and Detection, Peptides, Reagents for peptides synthesis, Assay Kits and Proteins.
21 - 40 of 1837
Glucagon-Like Peptide 1 GLP-1 (7-36) amide human mouse rat bovine guinea pig Biotin-labeled - 0.5 mg
- Biotin-HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
- Cat.Number : AS-23586
[Des-Arg10]-HOE I40, B1 Bradykinin Receptor Antagonist - 1 mg
- rRP-Hyp-G-Thi-S-(D-Tic)-Oic
- Cat.Number : AS-22970
Pancreatic Polypeptide, human
- APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH2
- Cat.Number : AS-22866
Fmoc-(N-beta-(2,4-dinitrophenyl))-L-alpha,beta-diaminopropionic acid - 1 g
- Cat.Number : AS-23380
Glucagon-Like Peptide 1, GLP-1 (7-36)-Lys(Biotin), amide, human, mouse, rat, bovine, guinea pig
- HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRK(Biotin)-NH2
- Cat.Number : AS-23642
PACAP (1-38), amide, human, ovine, rat, Biotin-labeled - 0.5 mg
- Biotin-HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2
- Cat.Number : AS-23590
Boc-Nalpha-methyl-O-benzyl-L-serine dicyclohexylammonium salt - 1 g
- Cat.Number : AS-23143-B1
21 - 40 of 1837