Products
Discover our full range of catalog products including Labeling and Detection, Peptides, Reagents for peptides synthesis, Assay Kits and Proteins.
21 - 40 of 1836
Thrombin Substrate, fluorescent (H-D-Phe-Pro-Arg-AFC) - 10 mg
- fPR-AFC
- Cat.Number : AS-24131
Plasminogen Activator Acrosine Substrate, fluorescent Z-Gly-Gly-Arg-AFC - 10 mg
- Z-GGR-AFC
- Cat.Number : AS-24143
SensoLyte® Anti-Mouse/Rat ß-Amyloid (1-40) Quantitative ELISA Kit Colorimetric - 1 kit
- Cat.Number : AS-55553
Beta-Amyloid (1-39) Peptide
- DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGV
- Cat.Number : AS-24295
SensoLyte® Anti-Human MOG (1-125) Human IgG Specific ELISA Kit Colorimetric - 1 kit
- Cat.Number : AS-55153-H
SensoLyte® Anti-Mouse MOG (1-125) IgG Quantitative ELISA Kit Colorimetric - 1 kit
- Cat.Number : AS-55156
[Arg8]-Vasopressin (AVP) Peptide
- CYFQNCPRG-NH2 (Disulfide bridge: 1-6)
- Cat.Number : AS-24289
21 - 40 of 1836