Peptides

AnaSpec manufactures many categories of peptides in Fremont, California, USA. Peptides represent over decades of innovative peptide synthesis expertise.

    21 - 40 of 1093

    PACAP (1-38), amide, human, ovine, rat, Biotin-labeled - 0.5 mg

    • Biotin-HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2
    • Cat.Number : AS-23590

    VIP, human, porcine, rat

    • HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2
    • Cat.Number : AS-22872

    PACAP (1-38)-Lys(Biotin), amide, human, ovine, rat - 0.5 mg

    • HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKK(Biotin)-NH2
    • Cat.Number : AS-23648

    Parathyroid Hormone (1-34)-Lys(Biotin), human - 1 mg

    • SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFK(Biotin)
    • Cat.Number : AS-23647

    [Lys3]-Bombesin - 5 mg

    • Pyr-QKLGNQWAVGHLM-NH2
    • Cat.Number : AS-22838

    Biotin-beta-Amyloid (1-42)

    • Biotin-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
    • Cat.Number : AS-23524-01

    Beta-Amyloid (1-38) Peptide

    • DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGG
    • Cat.Number : AS-24233

    Gastrin Releasing Peptide, human

    • VPLPAGGGTVLTKMYPRGNHWAVGHLM-NH2
    • Cat.Number : AS-24213

    Biotin-Oxytocin - 1 mg

    • Biotin-CYIQNCPLG-NH2 (Disulfide bridge: 1-6)
    • Cat.Number : AS-23994

    Cecropin A Peptide

    • KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2
    • Cat.Number : AS-24009

    ß-Endorphin, human - 1 mg

    • YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE
    • Cat.Number : AS-24319

    Orexin A, bovine, human, mouse, rat - 1 mg

    • Pyr-PLPDCCRQKTCSCRLYELLHGAGNHAAGILTL-NH2 (Disulfide bridge: 6-12 and 7-14)
    • Cat.Number : AS-24470

    Biotin-ACTH (1-39), human - 0.5 mg

    • Biotin-SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
    • Cat.Number : AS-23968

    Atrial Natriuretic Peptide (1-28), human, porcine, Biotin-labeled - 0.5 mg

    • Biotin-SLRRSSCFGGRMDRIGAQSGLGCNSFRY (Disulfide bridge: 7-23)
    • Cat.Number : AS-23972

    Corticotropin Releasing Factor, CRF, human, rat - 1 mg

    • SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2
    • Cat.Number : AS-24254

    Oxytocin Peptide

    • CYIQNCPLG-NH2 (Disulfide bridge: 1-6)
    • Cat.Number : AS-24275
      21 - 40 of 1093