Peptides

    21 - 40 of 1086

    5-FAM-PMDM6 - 1 mg

    • 5-FAM-(ß-A)-(ß-A)-FM-Aib-pY-(6-Cl-DL-Trp)-E-Ac3c-LN-NH2
    • Cat.Number : AS-63359-1-

    520 MMP FRET Substrate 1 - 0.1 mg

    • 5-FAM-PLGL-Dap(QXL® 520)-AR-NH2
    • Cat.Number : AS-60572-01

    520 MMP FRET Substrate 11 - 0.1 mg

    • 5-FAM-P-Cha-G-Nva-HA-Dap(QXL® 520)-NH2
    • Cat.Number : AS-60578-01

    520 MMP FRET Substrate 12 - 0.1 mg

    • 5-FAM-RPKPYA-Nva-WM-K(QXL® 520)-NH2
    • Cat.Number : AS-60579-01

    520 MMP FRET Substrate 13 - 0.1 mg

    • 5-FAM-RPKPVE-Nva-WRK(QXL® 520)-NH2
    • Cat.Number : AS-60580-01

    520 MMP FRET Substrate 14 - 0.1 mg

    • QXL® 520 -γ-Abu-P-Cha-Abu-Smc-HA-Dab(5-FAM)-AK-NH2 (Smc=S-Methyl-L-cysteine)
    • Cat.Number : AS-60581-01

    520 MMP FRET Substrate 15 - 0.1 mg

    • QXL® 520 -γ-Abu-PQGL-Dab(5-FAM)-AK-NH2
    • Cat.Number : AS-60582-01

    520 MMP FRET Substrate 3 - 0.1 mg

    • QXL® 520-PLGC(Me)HAr-K(5-FAM)-NH2
    • Cat.Number : AS-60570-01

    520 MMP FRET Substrate 4 - 0.1 mg

    • QXL® 520-PLGLWArK(5-FAM)-NH2
    • Cat.Number : AS-60568-01

    520 MMP FRET Substrate 6 - 0.1 mg

    • QXL® 520-PLGMWSRK(5-FAM)-NH2
    • Cat.Number : AS-60573-01

    520 MMP FRET Substrate 7 - 0.1 mg

    • QXL® 520-PYAYWMRK(5-FAM)-NH2
    • Cat.Number : AS-60574-01

    520 MMP FRET Substrate 9 - 0.1 mg

    • QXL® 520-RPLALWRK(5-FAM)-NH2
    • Cat.Number : AS-60576-01

    580 MMP FRET Substrate 8 - 0.1 mg

    • QXL® 570-KPLA-Nva-Dap(5-TAMRA)-AR-NH2
    • Cat.Number : AS-60585-01

    ACTH (1-10) - 5 mg

    • SYSMEHFRWG
    • Cat.Number : AS-20624

    ACTH (1-17) - 1 mg

    • SYSMEHFRWGKPVGKKR
    • Cat.Number : AS-60708

    ACTH (1-24), human

    • SYSMEHFRWGKPVGKKRRPVKVYP
    • Cat.Number : AS-20613

    ACTH (1-39), human

    • SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
    • Cat.Number : AS-20611

    ACTH (18-39), human (CLIP) - 1 mg

    • RPVKVYPNGAEDESAEAFPLEF
    • Cat.Number : AS-20619

    ACTH (7-38), human - 1 mg

    • FRWGKPVGKKRRPVKVYPNGAEDESAEAFPLE
    • Cat.Number : AS-20618
      21 - 40 of 1086