Peptides
AnaSpec manufactures many categories of peptides in Fremont, California, USA. Peptides represent over decades of innovative peptide synthesis expertise.
21 - 40 of 1051
Chlorotoxin (Cltx) - 0.1 mg
- MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR-NH2 (Disulfide bridge: 2-19,5-28,16-33,20-35)
- Cat.Number : AS-60770
MBP, MAPK Substrate [APRTPGGRR], Biotinylated - 1 mg
- Biotin-APRTPGGRR
- Cat.Number : AS-60747
bFGF (119-126), Basic Fibroblast Growth Factor, human, mouse, rat, rabbit, bovine - 1 mg
- KRTGQYKL
- Cat.Number : AS-61070
Calpain Inhibitor Peptide, B27-WT - 0.5 mg
- DPMSSTYIEELGKREVTIPPKYRELLA
- Cat.Number : AS-60844
MBP (88-104), guinea pig, MBP (89-105), human, MBP (86-102), mouse - 1 mg
- Ac-FFKNIVTPRTPPPSQGK-NH2
- Cat.Number : AS-60977
HNP-1, a-Defensin-1, Human Neutrophil Peptide-1 - 0.1 mg
- ACYCRIPACIAGERRYGTCIYQGRLWAFCC (Disulfide bridge: 2-30, 4-19, 9-29)
- Cat.Number : AS-60743
BAD (103-127), human, FAM-labeled - 0.5 mg
- FAM-NLWAAQRYGRELRRMSDEFVDSFKK
- Cat.Number : AS-60985
Angiotensin I Converting Enzyme 2, ACE-2/Caspase-1 Substrate - 1 mg
- Mca-YVADAPK(Dnp)
- Cat.Number : AS-60758
Proteases Substrate, Fluorogenic, (Z-R)2Rh110•2HCl - 5 mg
- (Z-R)2Rh110•2HCl
- Cat.Number : AS-60323-5
520 MMP FRET Substrate 12 - 0.1 mg
- 5-FAM-RPKPYA-Nva-WM-K(QXL® 520)-NH2
- Cat.Number : AS-60579-01
Casein Kinase 2 (CK2) Substrate alpha-subunit [RRRDDDSDDD] - 1 mg
- RRRDDDSDDD
- Cat.Number : AS-60615
21 - 40 of 1051