Catalog

AnaSpec offers high quality 95% purity catalog peptides for cancer and apoptosis, cell signaling, neuroscience, immunology and infectious diseases .

    21 - 40 of 1093

    Sauvagine - 0.5 mg

    • Pyr-GPPISIDLSLELLRKMIEIEKQEKEKQQAANNRLLLDTI-NH2
    • Cat.Number : AS-24475

    H-Ala-Pro-AFC - 10 mg

    • AP-AFC
    • Cat.Number : AS-24126

    ß-Secretase Inhibitor 1 - 1 mg

    • KTEEISEVN-Sta-VAEF (Sta = statine)
    • Cat.Number : AS-23958

    Cell Permeable-Mastoparan Peptide

    • INLKALAALAKKIL-NH2
    • Cat.Number : AS-24270

    Caerulein, Ceruletide - 1 mg

    • Pyr-QD-Y(SO3H)-TGWMDF-NH2
    • Cat.Number : AS-24252

    Beta-Amyloid (12-28) Peptide

    • VHHQKLVFFAEDVGSNK
    • Cat.Number : AS-24229

    Beta-Amyloid (1-39) Peptide

    • DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGV
    • Cat.Number : AS-24295

    Conantokin G - 0.5 mg

    • GE(Gla)(Gla)LQ(Gla)NQ(Gla)LIR(Gla)KSN-NH2
    • Cat.Number : AS-24281

    Substance P

    • RPKPQQFFGLM-NH2
    • Cat.Number : AS-24279

    Exendin 4

    • HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
    • Cat.Number : AS-24463

    B-type Natriuretic Peptide, BNP-32, human

    • SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Disulfide bridge: 10-26)
    • Cat.Number : AS-24015

    Angiotensin II Phosphate - 1 mg

    • DRV-pY-IHPF
    • Cat.Number : AS-24520

    Endothelin 3, human, rat, mouse, rabbit

    • CTCFTYKDKECVYYCHLDIIW (Disulfide bridge: 1-15 and 3-11)
    • Cat.Number : AS-24323

    [Arg8]-Vasopressin (AVP) Peptide

    • CYFQNCPRG-NH2 (Disulfide bridge: 1-6)
    • Cat.Number : AS-24289

    Biotin-Bradykinin - 1 mg

    • Biotin-RPPGFSPFR
    • Cat.Number : AS-23974

    Beta-Amyloid (11-22) - 1 mg

    • EVHHQKLVFFAE
    • Cat.Number : AS-23956
      21 - 40 of 1093