Products
Discover our full range of catalog products including Labeling and Detection, Peptides, Reagents for peptides synthesis, Assay Kits and Proteins.
901 - 920 of 1840
Calcein, AM UltraPure Grade, 5 mM solution in anhydrous DMSO - 200 µl
- Cat.Number : AS-89203
Caspase 3 (Apopain) Substrate 1r-z, fluorogenic - 5 mg
- (Z-DEVD)2-Rh110
- Cat.Number : AS-60304-5
Exendin 4, FAM-labeled - 0.5 mg
- FAM-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
- Cat.Number : AS-60280-05
901 - 920 of 1840