Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Gastric Inhibitory Peptides (GIPs)  >>  GIP (3-42), human

Product Name GIP (3 - 42), human
EGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
Size 1 mg
Catalog # AS-61227
US$ $357
Purity % Peak Area By HPLC ≥ 95%
Description

This peptide is from amino acid 3-42 of the full length 42-amino acid long GIP (Glucose-dependent Insulinotropic Polypeptide or also known as Gastric Inhibitory Polypeptide). The in-vivo degradation of the first two N-terminal amino acids (Tyr-Ala) by the enzyme dipeptidyl peptidase IV (DPP IV) results in making GIP (3-42) a potent antagonist as opposed to the agonist full length GIP on the GIP receptor.

Detailed Information Datasheet
Material Safety Data Sheets (MSDS)
Storage -20°C
References Gault, VA. et al. Endocrinol 175, 525 (2002), doi: 10.1677/joe.0.1750525
Molecular Weight 4759.4
Sequence
(One-Letter Code)
EGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
Sequence
(Three-Letter Code)
H - Glu - Gly - Thr - Phe - Ile - Ser - Asp - Tyr - Ser - Ile - Ala - Met - Asp - Lys - Ile - His - Gln - Gln - Asp - Phe - Val - Asn - Trp - Leu - Leu - Ala - Gln - Lys - Gly - Lys - Lys - Asn - Asp - Trp - Lys - His - Asn - Ile - Thr - Gln - OH
     
  < Back