Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Adrenomedullin Peptides  >>  Adrenomedullin (1-52), human

Product Name Adrenomedullin (1 - 52), human
YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY - NH2 (Disulfide bridge: 16 - 21)
Size 0.5 mg
Catalog # AS-60447
US$ $335
Purity % Peak Area By HPLC ≥ 95%
Description

Adrenomedullin (AM or ADM) is a 52-amino acid peptide initially isolated from pheochromyctoma, a tumor of the adrenal medulla, hence the name "Adrenomedullin." Growing evidence shows that Adrenomedullin has many biological action which includes vasodilatation, cell growth, regulation of hormone secretion, natriuresis, as well as possessing antimicrobial effects.

Detailed Information Datasheet
Storage -20C
References Kitamura, K. et al. (1993). Biochem Biophys Res Commun 192, 553, doi: 10.1006/bbrc.1993.1451
Hinson, JP. et al. Endocrine Rev 21 (2013), doi: http://dx.doi.org/10.1210/edrv.21.2.0396
Molecular Weight 6028.8
Sequence
(One-Letter Code)
YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 (Disulfide bridge: 16-21)
Sequence
(Three-Letter Code)
H - Tyr - Arg - Gln - Ser - Met - Asn - Asn - Phe - Gln - Gly - Leu - Arg - Ser - Phe - Gly - Cys - Arg - Phe - Gly - Thr - Cys - Thr - Val - Gln - Lys - Leu - Ala - His - Gln - Ile - Tyr - Gln - Phe - Thr - Asp - Lys - Asp - Lys - Asp - Asn - Val - Ala - Pro - Arg - Ser - Lys - Ile - Ser - Pro - Gln - Gly - Tyr - NH2 (Disulfide bridge: 16 - 21)
     
  < Back