Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Adrenomedullin Peptides  >>  Adrenomedullin (22-52), human

Product Name Adrenomedullin (22 - 52), human
TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY - NH2
Size 0.5 mg
Catalog # 60449
US$ $181
Purity % Peak Area By HPLC ≥ 95%
Description

AM (22-52) is known as an adrenomedullin receptor antagonist and a cardiac depressant factor, although there is some discrepancy in the literature regarding the selectivity of ADM 22-52 as adrenomedullin receptor antagonist.

Storage -20C
References Ref: Hyvelin, JM. et al. J. Card Surg. 17, 328 (2002); Ziolkowska, A. et al. Int. J. Mol. Med. 11, 613 (2003); Nishimatsu, H. et al. Hypertens. Res. 26 Suppl, S79 (2003).
Molecular Weight 3576
Sequence
(One-Letter Code)
TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2
Sequence
(Three-Letter Code)
H - Thr - Val - Gln - Lys - Leu - Ala - His - Gln - Ile - Tyr - Gln - Phe - Thr - Asp - Lys - Asp - Lys - Asp - Asn - Val - Ala - Pro - Arg - Ser - Lys - Ile - Ser - Pro - Gln - Gly - Tyr - NH2
Product Citations Bayram, Z. et al. (2010). The role of nitric oxide and potassium channels in the effect of adrenomedullin in human internal thoracic arteries. Regul Pept 161, 92.
Roh, Jaesook. et al. J. Biol. Chem. 279, 7264 (2004).
     
  < Back