Products
Discover our full range of catalog products including Labeling and Detection, Peptides, Reagents for peptides synthesis, Assay Kits and Proteins.
1 - 20 of 1837
Biotin-Oxytocin - 1 mg
- Biotin-CYIQNCPLG-NH2 (Disulfide bridge: 1-6)
- Cat.Number : AS-23994
Orexin A, bovine, human, mouse, rat - 1 mg
- Pyr-PLPDCCRQKTCSCRLYELLHGAGNHAAGILTL-NH2 (Disulfide bridge: 6-12 and 7-14)
- Cat.Number : AS-24470
Biotin-ACTH (1-39), human - 0.5 mg
- Biotin-SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
- Cat.Number : AS-23968
Atrial Natriuretic Peptide (1-28), human, porcine, Biotin-labeled - 0.5 mg
- Biotin-SLRRSSCFGGRMDRIGAQSGLGCNSFRY (Disulfide bridge: 7-23)
- Cat.Number : AS-23972
Corticotropin Releasing Factor, CRF, human, rat - 1 mg
- SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2
- Cat.Number : AS-24254
Beta-Amyloid (1-40) Peptide
- DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
- Cat.Number : AS-24235-
1 - 20 of 1837