Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Antimicrobial and Related Peptides  >>  Biotin-LC-LL-37

Product Name Biotin - LC - LL - 37
Biotin - LC - [LL-37, 37 aa]
Size 0.5 mg
Catalog # 63693
US$ $291
Purity % Peak Area By HPLC ≥ 95%
Detailed Information Datasheet
Storage -20C
Molecular Weight 4832.8
Sequence
(One-Letter Code)
Biotin-LC-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
Sequence
(Three-Letter Code)
Biotin - LC - Leu - Leu - Gly - Asp - Phe - Phe - Arg - Lys - Ser - Lys - Glu - Lys - Ile - Gly - Lys - Glu - Phe - Lys - Arg - Ile - Val - Gln - Arg - Ile - Lys - Asp - Phe - Leu - Arg - Asn - Leu - Val - Pro - Arg - Thr - Glu - Ser - OH
     
  < Back