Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  GPCR Peptide Ligands  >  Amylin  >>  Pramlintide, Acetate [Pro25, 28, 29]-Amylin(1-37), human, Amide

Product Name Pramlintide, Acetate [Pro25, 28, 29] - Amylin(1 - 37), human, Amide
KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY - NH2 (S - S Bond) acetate salt
Size 1 mg
Catalog # 64576-1
US$ $269
Description

Pramlintide is the first in the new class of amylinomimetic compounds and is a synthetic analogue of the human hormone Amylin, a 37 amino acid peptide. Pramlintide’s peptide sequence differs from Amylin by replacing proline at postitions 25, 28, and 29. Pramlintide has a disulfide bridge between C2 and C7. For Research Use Only.

Storage -20°C
References McQueen, J. Am. J. Health-System Pharmacy 62 2363 (2005).
Molecular Weight 3949.5
Sequence
(One-Letter Code)
KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-NH2 (S-S Bond) acetate salt
Sequence
(Three-Letter Code)
H - Lys - Cys - Asn - Thr - Ala - Thr - Cys - Ala - Thr - Gln - Arg - Leu - Ala - Asn - Phe - Leu - Val - His - Ser - Ser - Asn - Asn - Phe - Gly - Pro - Ile - Leu - Pro - Pro - Thr - Asn - Val - Gly - Ser - Asn - Thr - Tyr - NH2 acetate salt (S - S Bond)
     
  < Back