Peptides
AnaSpec manufactures many categories of peptides in Fremont, California, USA. Peptides represent over decades of innovative peptide synthesis expertise.
61 - 80 of 1093
pp60(v-SRC) Autophosphorylation Site, Phosphorylated - 1 mg
- RRLIEDNE-pY-TARG
- Cat.Number : AS-22555
Glucagon (1-29), bovine, human, rat, porcine
- HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
- Cat.Number : AS-22456
hBD-1, b-Defensin-1, human - 0.1 mg
- DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK (Disulfide bridge: 5-34, 12-27, 17-35)
- Cat.Number : AS-60740
HIV Substrate, HiLyte™ Fluor 488 - 0.1 mg
- QXL®520-GABA-SQNYPIVQ-K(HiLyte™ Fluor 488)-NH2
- Cat.Number : AS-60635
61 - 80 of 1093