Products
Discover our full range of catalog products including Labeling and Detection, Peptides, Reagents for peptides synthesis, Assay Kits and Proteins.
681 - 700 of 1837
Apamin - 0.5 mg
- CNCKAPETALCARRCQQH-NH2 (Disulfide bridge: 1-11; 3-15)
- Cat.Number : AS-60772
Beta-Amyloid (3-40) - 0.1 mg
- EFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
- Cat.Number : AS-61029
ARP [N-(Aminooxyacetyl)-N'-(D-biotinoyl) hydrazine, TFA salt] - 10 mg
- Cat.Number : AS-60645
Cys(Npys) Antennapedia Peptide, amide - 1 mg
- C(Npys)-RQIKIWFQNRRMKWKK-NH2
- Cat.Number : AS-61034
681 - 700 of 1837