Products
Discover our full range of catalog products including Labeling and Detection, Peptides, Reagents for peptides synthesis, Assay Kits and Proteins.
1321 - 1340 of 1840
SARS-CoV Peptide Antigen Positive control - 1mg NET peptide
- KLPDDFMGCV
- Cat.Number : AS-65631
SARS - CoV - 2 Spike RBM (receptor binding motif), 438 - 458 - 0.5 mg
- SNNLDSKVGGNYNYLYRLFRK
- Cat.Number : AS-65615
SensoLyte® 520 ß-Secretase (BACE1) Activity Assay Kit Fluorimetric - 1 kit
- Cat.Number : AS-71144
SARS-CoV-2 Spike receptor binding domain, RBD (523-541) - 0.5 mg
- TVCGPKKSTNLVKNKCVNF
- Cat.Number : AS-65625
SARS - CoV - 2 Spike RBM (receptor binding motif), 450 - 473 - 0.5 mg
- NYLYRLFRKSNLKPFERDISTEIY
- Cat.Number : AS-65617
SARS-CoV-2 Spike receptor binding domain, RBD (513-520) - Lys(Biotin-LC) - 0.1 mg
- LSFELLHA-K(Biotin-LC)-NH2
- Cat.Number : AS-65624
SensoLyte® 490 HCV Protease Assay Kit Fluorimetric 500 assays - 1 kit
- Cat.Number : AS-71126
SARS-CoV-2 Spike receptor binding domain, RBD (395-430) - Lys(Biotin-LC) - 0.1 mg
- VYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFT-K(Biotin-LC)-NH2
- Cat.Number : AS-65614
SensoLyte® Plus 520 MMP-13 Assay Kit Fluorimetric and Enhanced Selectivity - 1 kit
- Cat.Number : AS-72019
1321 - 1340 of 1840