Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Amyloid Peptides  >  Beta-Amyloid (1-40) and Related Peptides  >>  [Ala28]-beta-Amyloid (1-40), Human

Product Name [Ala28] - beta - Amyloid (1 - 40), Human
DAEFRHDSGYEVHHQALVFFAEDVGSNAGAIIGLMVGGVV
Size 0.5 mg
Catalog # 61968-05
US$ $423
Purity % Peak Area By HPLC ≥ 95%
Description

This is amino acids 1 to 40 fragment of the -Amyloid peptide, with lysines at positions 16 and 28 replaced with alanines.

Storage -20C
Molecular Weight 4215.7
Sequence
(One-Letter Code)
DAEFRHDSGYEVHHQALVFFAEDVGSNAGAIIGLMVGGVV
Sequence
(Three-Letter Code)
H - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Ala - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Ala - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - OH
     
  < Back