Peptides

Your selection

    1 - 16 of 16

    OVA (241-270) - 1 mg

    • SMLVLLPDEVSGLEQLESIINFEKLTEWTS
    • Cat.Number : AS-64525

    OVA (257-264) Peptide Fragment

    • SIINFEKL
    • Cat.Number : AS-60193-1

    OVA (257-264), FAM labeled - 1 mg

    • 5-FAM-SIINFEKL-NH2
    • Cat.Number : AS-64231

    OVA (257-264), amide - 5 mg

    • SIINFEKL-NH2
    • Cat.Number : AS-62572-5

    OVA (323-339)

    • ISQAVHAAHAEINEAGR
    • Cat.Number : AS-27024

    OVA (323-339), FITC-labeled - 1 mg

    • FITC-LC-ISQAVHAAHAEINEAGR
    • Cat.Number : AS-64766

    OVA (323-339), TAMRA labeled - 1 mg

    • 5-TAMRA-ISQAVHAAHAEINEAGR
    • Cat.Number : AS-64232

    OVA (323-339), amide

    • ISQAVHAAHAEINEAGR-NH2
    • Cat.Number : AS-62571-1

    OVA (323-339), biotin-labeled - 1 mg

    • Biotin-ISQAVHAAHAEINEAGR
    • Cat.Number : AS-64767

    OVA (329-337) - 1 mg

    • AAHAEINEA
    • Cat.Number : AS-64777
      1 - 16 of 16