Peptides

Your selection

    1 - 20 of 150

    Histone H1-derived Peptide - 1 mg

    • GGGPATPKKAKKL
    • Cat.Number : AS-61761

    Histone H2A (1-20) - 1 mg

    • SGRGKQGGKARAKAKTRSSR
    • Cat.Number : AS-63676

    Histone H2A (1-20)-GGK(Biotin) - 1 mg

    • SGRGKQGGKARAKAKTRSSR-GGK(Biotin)
    • Cat.Number : AS-64842-1

    Histone H2A (1-22)-GK(Biotin)-NH2 - 1 mg

    • SGRGKQGGKARAKAKSRSSRAG-GK(Biotin)-NH2
    • Cat.Number : AS-64639-1

    Histone H2B (21-41)-GGK(Biotin) - 1 mg

    • AQKKDGKKRKRSRKESYSIYV-GGK(Biotin)
    • Cat.Number : AS-64385-1

    Histone H3 (1-20) - 1 mg

    • ARTKQTARKSTGGKAPRKQL
    • Cat.Number : AS-62753

    Histone H3 (1-21) - 1 mg

    • ARTKQTARKSTGGKAPRKQLA
    • Cat.Number : AS-61701

    Histone H3 (1-21)-GGK(Biotin)-NH2 - 1 mg

    • ARTKQTARKSTGGKAPRKQLA-GGK(Biotin)-NH2
    • Cat.Number : AS-61702

    Histone H3 (1-21)-GGK(FAM)-NH2 - 1 mg

    • ARTKQTARKSTGGKAPRKQLA-GGK(FAM)-NH2
    • Cat.Number : AS-63824

    Histone H3 (1-25), amide - 1 mg

    • ARTKQTARKSTGGKAPRKQLATKAA-NH2
    • Cat.Number : AS-61703

    Histone H3 (1-35) - 0.25 mg

    • ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGV
    • Cat.Number : AS-65364-025

    Histone H3 (1-50)-GGK(Biotin) - 0.25 mg

    • ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALRE-GGK(Biotin)
    • Cat.Number : AS-65366-025

    Histone H3 (1-8) - 1 mg

    • ARTKQTAR
    • Cat.Number : AS-65152

    Histone H3 (116–136) - 1 mg

    • KRVTIMPKDIQLARRIRGERA
    • Cat.Number : AS-61704

    Histone H3 (15-36)-GGK(Biotin) - 1 mg

    • APRKQLATKAARKSAPATGGVK-GGK(biotin)
    • Cat.Number : AS-65415-1

    Histone H3 (21-44) - 1 mg

    • ATKAARKSAPATGGVKKPHRYRPG
    • Cat.Number : AS-64454-1

    Histone H3 (21-44)-GK(Biotin)

    • ATKAARKSAPATGGVKKPHRYRPG-GK(Biotin)
    • Cat.Number : AS-64440-025

    Histone H3 (21-44)-GK(Biotin)-NH2 - 1 mg

    • ATKAARKSAPSTGGVKKPHRYRPG-GK(Biotin)-NH2
    • Cat.Number : AS-64641-1

    Histone H3 (23-34) - 1 mg

    • KAARKSAPATGG
    • Cat.Number : AS-64375-1
      1 - 20 of 150