Peptides

    1 - 20 of 198

    Ala-gamma-D-Glu-DAP - 1 mg

    • A-(γ-e)-DAP
    • Cat.Number : AS-60774

    Apidaecin IB - 1 mg

    • GNNRPVYIPQPRPPHPRL
    • Cat.Number : AS-62044

    BMAP-18

    • GRFKRFRKKFKKLFKKLS
    • Cat.Number : AS-65597

    BMAP-27

    • GRFKRFRKKFKKLFKKLSPVIPLLHLG
    • Cat.Number : AS-65598

    Bac2A; Bactenecin 2A - 1 mg

    • RLARIVVIRVAR-NH2
    • Cat.Number : AS-64906

    Bactenecin, bovine - 0.5 mg

    • RLCRIVVIRVCR (Disulfide bridge: 3-11)
    • Cat.Number : AS-61066

    Bacterial Sortase Substrate I, FRET - 1 mg

    • DABCYL-LPETG-EDANS
    • Cat.Number : AS-62231

    Buforin 2 - 1 mg

    • TRSSRAGLQFPVGRVHRLLRK
    • Cat.Number : AS-61255

    C34, gp41 HIV Fragment - 1 mg

    • WMEWDREINNYTSLIHSLIEESQNQQEKNEQELL
    • Cat.Number : AS-62101

    C3a (70-77) - 1 mg

    • ASHLGLAR
    • Cat.Number : AS-61118

    C5a Receptor Agonist, mouse, human - 1 mg

    • FKP-(D-Cha)-Cha-r
    • Cat.Number : AS-65121

    CAP-18, rabbit - 0.5 mg

    • GLRKRLRKFRNKIKEKLKKIGQKIQGLLPKLAPRTDY
    • Cat.Number : AS-61307
      1 - 20 of 198