Products
Discover our full range of catalog products including Labeling and Detection, Peptides, Reagents for peptides synthesis, Assay Kits and Proteins.
1 - 20 of 21
HIV Substrate, HiLyte™ Fluor 488 - 0.1 mg
- QXL®520-GABA-SQNYPIVQ-K(HiLyte™ Fluor 488)-NH2
- Cat.Number : AS-60635
T20, Enfuvirtide - 1 mg
- Ac-YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF-NH2
- Cat.Number : AS-61235
HCV NS3/4A Protease Substrate - 1 mg
- Ac-DE-Dap(QXL®520)-EE-Abu-ψ-[COO]AS-C(5-FAMsp)-NH2
- Cat.Number : AS-60798
HCV Protease FRET Substrate (RET S1)
- Ac-DE-D(Edans)-EE-Abu-ψ-[COO]-AS-K(Dabcyl)-NH2
- Cat.Number : AS-22991
SensoLyte® 570 West Nile Virus Protease Assay Kit Fluorimetric - 1 kit
- Cat.Number : AS-72080
SensoLyte® 440 West Nile Virus Protease Assay Kit Fluorimetric - 1 kit
- Cat.Number : AS-72079
SensoLyte® 490 HCV Protease Assay Kit Fluorimetric 500 assays - 1 kit
- Cat.Number : AS-71126
Prostatic Acid Phosphatase (248-286), PAP (248-286) - 1 mg
- GIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMY
- Cat.Number : AS-64518
1 - 20 of 21