Products
Discover our full range of catalog products including Labeling and Detection, Peptides, Reagents for peptides synthesis, Assay Kits and Proteins.
521 - 540 of 1837
Cyclo (RGDfC), avb3 Integrin Binding Cyclic RGD Peptide - 1 mg
- Cyclo(-RGDfC)
- Cat.Number : AS-63785-1
HCAM-2, pertussis toxin substrate - 1 mg
- 6-FAM-VFDAVTDVIIKNNLKECGLY
- Cat.Number : AS-62058
Kinase Substrates Library, Group I, biotinylated, 180 distinct peptide mixtures - 1 Set
- Cat.Number : AS-62017-1
Glucagon-Like Peptide-2, GLP-2 (1-34), human - 1 mg
- HADGSFSDEMNTILDNLAARDFINWLIQTKITDR
- Cat.Number : AS-62068
521 - 540 of 1837