Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  GPCR Peptide Ligands  >  GIPs  >>  GIP (1-30), porcine, amide

Product Name GIP (1 - 30), porcine, amide
YAEGTFISDYSIAMDKIRQQDFVNWLLAQK - NH2
Size 1 mg
Catalog # 61230
US$ $303
Storage -20C
Molecular Weight 3551
Sequence
(One-Letter Code)
YAEGTFISDYSIAMDKIRQQDFVNWLLAQK-NH2
Sequence
(Three-Letter Code)
H - Tyr - Ala - Glu - Gly - Thr - Phe - Ile - Ser - Asp - Tyr - Ser - Ile - Ala - Met - Asp - Lys - Ile - Arg - Gln - Gln - Asp - Phe - Val - Asn - Trp - Leu - Leu - Ala - Gln - Lys - NH2
     
  < Back