Alzheimer's Disease
  Amyloid Precursor Protein (APP) / Amyloid Precursor-like Protein (APLP)

 Product Size Catalog # US$
Beta-Amyloid A4 Protein Precursor (740-770), APP (C31)
AAVTPEERHLSKMQQNGYENPTYKFFEQMQN
1 mg AS-62073 $253
  < Back