Neurodegenerative Disorders Related
  Beta-Amyloid Peptide Fragments

 Product Size Catalog # US$
Beta-Amyloid (1-11), Human
DAEFRHDSGYE
1 mg AS-22819 $71
Beta-Amyloid (1-16), Human
DAEFRHDSGYEVHHQK
1 mg AS-24225 $83
Beta-Amyloid (1-16), Human
DAEFRHDSGYEVHHQK
5 mg AS-24226 $341
Beta-Amyloid (1-16)-Lys(Biotin-LC)-NH2, Human
DAEFRHDSGYEVHHQK-K(Biotin-LC)-NH2
1 mg AS-62136 $181
Beta-Amyloid (1-38), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGG
0.5 mg AS-24233 $154
Beta-Amyloid (1-38), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGG
1 mg AS-24234 $275
Beta-Amyloid (1-39), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGV
0.5 mg AS-24295 $181
Beta-Amyloid (10-26), Human
YEVHHQKLVFFAEDVGS
1 mg AS-62885 $105
Beta-Amyloid (11-25), Human
EVHHQKLVFFAEDVG
1 mg AS-62884 $93
Beta-Amyloid (25-35), HiLyte™ Fluor 488-labeled, Human, mouse/rat
HiLyte™ Fluor 488-GSNKGAIIGLM
0.1 mg AS-63308 $110
ClearPoint™ beta-Amyloid (1-38), 13C-Phe & Ile, Human
DAEFRHDSGYEVHHQKLV-*F-*F-AEDVGSNKGA-*I-*I-GLMVGG *F=Phe(U-13C9), *I=Ile(U-13C6)
0.05 mg AS-65220 $117
  < Back