Catalog
AnaSpec offers high quality 95% purity catalog peptides for cancer and apoptosis, cell signaling, neuroscience, immunology and infectious diseases .
721 - 740 of 1093
Angiotensin I Converting Enzyme 2, ACE-2/Caspase-1 Substrate - 1 mg
- Mca-YVADAPK(Dnp)
- Cat.Number : AS-60758
[Des-octanoyl]-Ghrelin, rat, mouse - 1 mg
- GSSFLSPEHQKAQQRKESKKPPAKLQPR
- Cat.Number : AS-60981
Renin Inhibitor Peptide, WFML Peptide, rat - 1 mg
- Ac-HPFV-(Sta)-LF-NH2
- Cat.Number : AS-60463-1
Elastase Substrate, fluorogenic, (Z-AAAA)2Rh110 - 5 mg
- (Z-AAAA)2Rh110
- Cat.Number : AS-60321-5
Adrenomedullin (22-52), human - 0.5 mg
- TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2
- Cat.Number : AS-60449
Glucagon (1-29), bovine, human, rat, porcine, Biotin-labeled
- Biotin-HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
- Cat.Number : AS-60274-05
721 - 740 of 1093