Products
Discover our full range of catalog products including Labeling and Detection, Peptides, Reagents for peptides synthesis, Assay Kits and Proteins.
41 - 60 of 1838
Endothelin 3, human, rat, mouse, rabbit
- CTCFTYKDKECVYYCHLDIIW (Disulfide bridge: 1-15 and 3-11)
- Cat.Number : AS-24323
[Arg8]-Vasopressin (AVP) Peptide
- CYFQNCPRG-NH2 (Disulfide bridge: 1-6)
- Cat.Number : AS-24289
Bradykinin Antagonist, HOE I40 - 1 mg
- rRP-(Hyp)-G-(Thi)-S-(D-Tic)-(Oic)-R
- Cat.Number : AS-22968
Cys-beta-Amyloid (1-42)
- CDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
- Cat.Number : AS-23537
Corticotropin Releasing Factor, CRF, ovine - 0.5 mg
- SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA-NH2
- Cat.Number : AS-22932
[Succinyl-Asp6, NMePhe8]-Substance P (6-11), Senktide - 5 mg
- Suc-DF-(NMeF)-GLM-NH2
- Cat.Number : AS-22887
Growth Hormone Releasing Factor, GRF (1-29), amide, human
- YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2
- Cat.Number : AS-22874
Calcitonin Gene Related Peptide, CGRP (alpha) (8-37), human - 1 mg
- VTHRLAGLLSRSGGVVKNNFVPTNVGSKAF-NH2
- Cat.Number : AS-22857
HCV Protease FRET Substrate (RET S1)
- Ac-DE-D(Edans)-EE-Abu-ψ-[COO]-AS-K(Dabcyl)-NH2
- Cat.Number : AS-22991
41 - 60 of 1838