Labeling & detection

AnaSpec offers labeling and detection products such as biotin and streptavidin derivatives, fluorescent and non-fluorescent dyes.

    41 - 60 of 331

    Thrombin Substrate S2238 1 mg

    • f-Pip-R-pNA
    • Cat.Number : AS-63776

    Plasmepsin V FRET Substrate - 1 mg

    • Dabcyl-LNKRLLHETQ-EDANS
    • Cat.Number : AS-64939

    ADAMTS-13 FRET Substrate, FRETS-VWF73

    • DRE-Dap(Nma)-APNLVYMVTG-Dap(Dnp)-PASDEIKRLPGDIQVVPIGVGPNANVQELERIGWPNAPILIQDFETLPREAPDLVLQR
    • Cat.Number : AS-63728-01

    Syk Kinase Peptide Substrate, Biotin labeled - 1 mg

    • Biotin-KEDPDYEWPSAK-NH2
    • Cat.Number : AS-64140

    Syk Kinase Peptide Substrate - 1 mg

    • KEDPDYEWPSAK-NH2
    • Cat.Number : AS-64141

    520 MMP FRET Substrate IV - 0.1 mg

    • QXL® 520-PLGLWArK(5-FAM)-NH2
    • Cat.Number : AS-60568-01

    520 MMP FRET Substrate 1 - 0.1 mg

    • 5-FAM-PLGL-Dap(QXL® 520)-AR-NH2
    • Cat.Number : AS-60572-01

    ADAMTS-4/Aggrecanase FRET Substrate, WAAG-3R - 1 mg

    • Abz-TEGEARGSVI-Dap(Dnp)-KK-NH2
    • Cat.Number : AS-60431-1
      41 - 60 of 331