Labeling & detection

AnaSpec offers labeling and detection products such as biotin and streptavidin derivatives, fluorescent and non-fluorescent dyes.

    41 - 60 of 328

    Plasmepsin V FRET Substrate - 1 mg

    • Dabcyl-LNKRLLHETQ-EDANS
    • Cat.Number : AS-64939

    ADAMTS-13 FRET Substrate, FRETS-VWF73

    • DRE-Dap(Nma)-APNLVYMVTG-Dap(Dnp)-PASDEIKRLPGDIQVVPIGVGPNANVQELERIGWPNAPILIQDFETLPREAPDLVLQR
    • Cat.Number : AS-63728-01

    Syk Kinase Peptide Substrate, Biotin labeled - 1 mg

    • Biotin-KEDPDYEWPSAK-NH2
    • Cat.Number : AS-64140

    Syk Kinase Peptide Substrate - 1 mg

    • KEDPDYEWPSAK-NH2
    • Cat.Number : AS-64141

    Enterokinase Substrate - 1 mg

    • GDDDDK-ßNA
    • Cat.Number : AS-62974

    Thrombin Substrate S2238 1 mg

    • f-Pip-R-pNA
    • Cat.Number : AS-63776

    520 MMP FRET Substrate IV - 0.1 mg

    • QXL® 520-PLGLWArK(5-FAM)-NH2
    • Cat.Number : AS-60568-01
      41 - 60 of 328